dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|297527196|ref|YP_003669220.1| (Staphylothermus hellenicus DSM 12710)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2'-5' RNA ligase [Staphylothermus hellenicus DSM 12710]
Sequence length 190
Sequence
MSRENLRVFVAIDISDPNVLDRLSRIRDLLLESKADLKPVATENMHITLRFIGETPIHLV
NNICDDLGNIEFESFKIRIKGVGVFPNIARPRVIWAGVSQGVENLSKLHDIVEKILRKHG
IPPQREKFIPHITLARVKSGRNISRLVKIIESIADTDFGEAVVDKIVLKRSILTPSGPIY
RDICEAKARE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]