dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|296502971|ref|YP_003664671.1| (Bacillus thuringiensis BMB171)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcriptional regulator [Bacillus thuringiensis BMB171]
Sequence length 185
Sequence
MEEIQLILAKNLKLIREKEKLSLEKVSQLTGVSKTMIGQIERGDSSPTLTTIWKIANGLK
VSFTSLINNPQPDTKVVLRNDVQVLSEDNGRYKVYPSFPFQDNRNFEIYMVEIDTEGKLS
SEAHKEGTEEFITVFEGKLTIDINDCQYTLNNGDSIRFKADRPHTYTNSGRTLTRLSMTI
YYPAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]