dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302036660|ref|YP_003796982.1| (Candidatus Nitrospira defluvii)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 30S ribosomal protein S12 [Candidatus Nitrospira defluvii]
Sequence length 123
Sequence
MPTINQLVRKGRTLVKSKTKSPALKRCPQKRGVCLRVYTTTPKKPNSALRKVARVRLTNG
MEVTTYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGSLDAVGVADRKQARSKYGAK
RPK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]