dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|302037376|ref|YP_003797698.1| (Candidatus Nitrospira defluvii)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment lysyl-tRNA synthetase [Candidatus Nitrospira defluvii]
Sequence length 493
Sequence
MDELNDQRQQRIKKLDHLRQLGVAPYGTRFEVKDRAGQLTRLHGEKTKEVLEQEQISCTI
AGRIVGLRRFGKAAFAVLQDGSDRLQVYLKKDTLGEQAHQISEGLDLGDWIGVTGVLFRT
KTNEFTVEVKVLTFLSKALRPLPEKWHGLTDVETRYRQRYVDLIANPQVHQIFALRSRIV
SGIRAFLIERGFLEVETPMMHPIPGGAAAKPFVTHHNALGAELYLRIAPELYLKRLIVGG
FPRVFEINRNFRNEGISTIHNPEFTMLEFYVSYADYHDLIVLTEELFGRLAQDILGTTTI
DYQGTHINLGSPWRRWSYHQSILEVNSLPPSVLTNRDEALAAAQRLGVEVSPKESLVNIL
NEIFEETVEPRLQQPTFITDYPIEISPLARRKDSDPSLTDRFELYIAGREIANAFSELND
PLDQRERFEAQAAKHAAGDEEAHRVDEDFLRALEYGMPPTAGEGIGIDRLVMLFTNQSSI
RDVVLFPQLRPEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]