dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386345981|ref|YP_006044230.1| (Spirochaeta thermophila DSM 6578)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sporulation domain-containing protein [Spirochaeta thermophila DSM 6578]
Sequence length 224
Sequence
MDRERILVVLVGVSVFLLVVVLVGMWWLTPREEKPVQVVTAGEQPRQSGFDAVEWVREGE
GFPGLLEGEEPLEGEFIVTETLFGSESPTPSPAPVAVQAAPSPTPVRPVSRGDRAPAPSP
TRTPTPRVETRAVEHTPTPVVREEFWIQIASFTSQARAAHVVEDLGEKGITARIVTKTMD
GVTYYRVRLGPYEKKAEAEKFLASIRNLEGYEKSYISLVYRRDP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]