dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386347806|ref|YP_006046055.1| (Spirochaeta thermophila DSM 6578)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Spirochaeta thermophila DSM 6578]
Sequence length 330
Sequence
MRKLFFLLLLVCVMVAVFPSCSLNKMITRAVVSSLGTGGADPFSTEEDPQLVAEALPFAL
KLYETLLQSDPDNRELLLTLAQGYVSYAKAFVEEPARRLPLSSYAAQKKAYRRARLLYLR
GARYALHALEEAHPRAFAEWEGGDLSTFLGTVREEDVAALYWGAAGLLSAISLDPSDPEL
SLSIPKAVSLAATILLSFPDSQEGAVHEMFISLYGGLPEALWWGPNPPELLVEGLRRYYE
SEGLADATPEGKARHHFERAVALSGGKKLSPYITYAESIVYPRQDKDTYRNLLERALSIP
PGDTPEHALENAVAREKAEWLLETLDDRFF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]