dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|25027870|ref|NP_737924.1| (Corynebacterium efficiens YS-314)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATP synthase F0F1 subunit gamma [Corynebacterium efficiens YS-314]
Sequence length 326
Sequence
MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQKVLERLASAS
SLDHPMLREREGGKRAAVLVVSSDRGMAGGYNHNVFKKAAELEKLLAEQGYEVVRYVTGS
KGVGYYKFREDYVAGAWTGFSQDPDWNATHDVRRHLIDGFTATSDGTAKWRDGLNVAEGQ
EIQGFDQVHVVYTEFVSMLTQKPVVHQLLPVEPVIEDDIFERGESALSDGKNEIEPDYEF
EPDADTLLEALLPQYISRRLFSIFLEAAAAESASRRNAMKSATDNATELVKDLSRVANAA
RQAQITQEITEIVGGAGALSGSGESD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]