dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000231799|PACid:22673471 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 614
Sequence
MQASLSLPALSHAVPRSNYVVQSALPLPPSKPINLRFCGLHREALGFSHLAXSDSHRVRL
SAPSRSATISASSSSGNAXPPKSFDYDLLIIGAGVGGHGAALHAVEKGLKTAIVEGDVVG
GTCVNRGCVPSKALLAVSGRMRELQNEHHLKALGLQVSAAGYDRQGVADHANNLATKIRN
SLTNSMNSLGVDILTGVGTILGPQKVQIGSSDKVXTAKDIIIATGSVPFVPKGVEVDGKT
VITSDHALKLEFVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEIGKL
AQRVLINPRKIDYQTGVFASKITPAKDGKPVTIDLIDAKTKEPKETLEVDAALIATGRAP
FTQGLGLENVDVATQRGFIPVDERMRVIDANGKLVPHLFCIGDANGKMMLAHAASAQGIS
VVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAREKAEKEGFEVSIAKTSFKANTK
ALAENEGEGLAKLIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQXIKFAVHAHP
TLSEVLDELFKSAKVAHVSSPGVSASFISQERRDQHPEKRRNLRESXTTWPEIFFAFVAW
ILSSVHGLKKHLYS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]