dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MDP0000288439|PACid:22643642 (Malus domestica v196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 961
Sequence
MGXFIVSVPPVCSSGPVLFMDSRIYSDFFLMAGQTLPRKTTSDVNQVSGKSFDYIIVGGG
TAGCPLAATLSEKFSVLLVERGGSPYENPLIMENKNFGLSLVQTDEYTSVAQSFVSKDGG
FQSPRKSSRRRIGYQRRIVSDAYKWVESRNAFKPKLTPWPYVAELSLLEAGIFPYNGFSL
DHIEGTKIGATIYDEQGRRHXSADLLMAGNPNNITLLLNATVTSIIFHKKGNRNVTVVRG
IRFIKSDGSSSQTHEAYLNTQNNSRSSTGDVILAAGALGSPQILLLSGIGPXKHLNKFDI
PVAVNLKSVGKGMQDNPSIALVPXVADAKPKNFPPDSPKVIAIADDFKLIVGSMILPISF
NATIMLISGKLAFPESEGQLELNSTDPRKNPSVTFNYLATEKDMAECVKLGRLLEQIVRS
KSIAYFLGVEGKRRNESMSTDDELRKLCKNNVRTFYHYHGGQTLPRKTTSDVNQVSGKSF
DYIIVGGGTAGCPLAATLSEKFSVLLVERDTRSYLDLSLFVSRVLSHLREKRRFTGKLGA
MASSSGTGAGRVLGGGSAINGGFFSRASXDYVKRVGWNKEMVSDAYKWVESRNAFKPKLT
PWQYVAELSFLEAGIFPYNGFSLDHIEGTKIGATTFDEQGRRHTSADLLTAGNPNXITLL
LNATVTSIIFHEKGSRYETIVRGIRFIKSDGSSSQTHEAYLNTQNNSRSSTGDVILAAGA
LGSPQILLLSGIGPQKHLNKFNIPVAVNLKSVGKGMTDNPCIALLAEIADAKPKNFPPDS
PKVTVIADDFKLVIQALILPXSFNATIMPIVGKLAFPESEGELELNSTDPRKNPSVTFNY
LAKEKDMAECVKLGRLLEKIVRSKSIAYFLGIEGKRRNXSMSTDDELRKLCKNNVRTFYH
YHGGCTMGSVVDKNYRVFGIXGLRVIDGSTFLESPGTNPMATLLMLGRYQGIKILQEREN
A

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]