dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|94986321|ref|YP_605685.1| (Deinococcus geothermalis DSM 11300)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8/S53 subtilisin kexin sedolisin [Deinococcus geothermalis DSM 11300]
Sequence length 891
Sequence
MNKTAKTLALLSLSLVLGACGQSGAPTATAPQGALLPASAHANNLTPSRWFVELEGDPTA
LGTQSISSQQASFRAQAQSLGLHYQEVRSYNTLFNGFSVIATGSEINRISRMPGVLGVYP
VHRVDLPKPDLQAALQPQMFYAKGMTGADIAQNELGLTGKGVKVGVIDTGIDVDHPAFQG
RIVAGYDFVGDDYGKDGKYVPVPDDNPDDCNGHGTHVAGIVGGNDPATGFKGVAPEVSFG
AYRIFGCEGSSYDDVILAAMERAQKDGMQVINMSLGSAFENWKETPLAKAADRLVKKGVV
VVASGGNSGANGQYSMGGPTMGDNVISVASVDNVKVDLDSFTLSDGSKVGYYVATGAPEP
TKGLTLPITKKPGSTTTTPNDGCTASGGFAAGSLTGKAVLIRRGGCTFYEKASNAQKAGA
AAVILYNNAAGYISPTVSGEPPITIPVVAISDTDGAKINSLLGSGVSVTFDGGKIAVANP
TGNTISSFSSIGMSAELELKPDIAAPGGNIYSSYPLSADPSGYAVLSGTSMASPHVAGAA
ALMLQAYPNTQAKDMRTLLMNTASLRWFYNNKPLEGIPDYVQRQGAGMVDIVNAYDNTVR
ATPSKLSLGESETFATRSKVVVLKNTGAKREVYQVTHVPALTISGTTNAPKPSGAVASMT
INGTDVDNGSLEVVVPPFGEVELNVTITPPGGAADNSQYGGYISLKSATGANLVVPYSGF
KGDYQSLKSFGDVTLDGKTRLNFPILVDDAADDFYQEGQTLNAVPDYTFKKVEVTYSDGT
KATVLDAPYLLANLAHQIRTLTFELLDANGNVVDTLGKYNYLSRDCTDDYTKTSSTCTAF
EAFDWDGKLSNGQDAPNGLYQLRLRALKPLGDESNPAHTEVYTSQRFAVVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]