dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|296268459|ref|YP_003651091.1| (Thermobispora bispora DSM 43833)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Tbis_0470 [Thermobispora bispora DSM 43833]
Sequence length 120
Sequence
MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESAWFALPGRAKEFRLPE
ATPLEDLLDAVLTGGKVTLCTQCAARRGITVDDVIEGIRIAGAPTFVEEVLAEGAQALVY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]