dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|297621147|ref|YP_003709284.1| (Waddlia chondrophila WSU 86-1044)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanyl-tRNA synthetase alpha chain [Waddlia chondrophila WSU 86-1044]
Sequence length 342
Sequence
MQAEIETLKKTFTAEIDQACSTASLEELKIKYLGRKGPVQDLMKSLKNASKEERPALGKL
INDLKEEISNGINGKYDDLLIVEEDRKIKEETIDITLPGKRRFSGRKHVITQSIDTILEI
LIGMGFSVQYGPDIDTDYYNYEALNFPEDHPARDMQDTFYITDNVLLRSHTSNVQTRVME
SAEPPIRIIAPGKTYRNETITARSHVFFHQIEALYIDKGVTFGDLLSTLDEFLSKLFDHD
VKTRYRPSYFPFVEPGLEVDVSCLSCSGKGCTLCKHTGWLEVAGAGMVHPEVLKNGNIDP
EIYTGYAWGLGVERLAMLKHGIKDIRLFTENHIRFLEQFPAI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]