dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|330838173|ref|YP_004412753.1| (Selenomonas sputigena ATCC 35185)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment flagellar hook-associated protein FlgK [Selenomonas sputigena ATCC 35185]
Sequence length 571
Sequence
MVRGIYNNQLSLDTVGHNITNANTEGYSRQRVNPAATRPLEQGGMFGGLFVGTGVDSESL
TRARDFFADKQYWQEEATESYAKYRQKNYDKIEAVFNDSKTKGLQNAMHKFYSAWNDLSV
YASDPAKRVSVVESGKQFADRLEESAQNVQKQLDLVYREMDTQVKDVNEITQKIVELNKN
ISLAEANGAMANDLRDKRDLLVDKLSGYMSLHVYEMDNGMYQIVSGGASIVNGISRLELK
MDGPVENKRYGVNDYSLIFKDTNTLFVPGNGTLQAAVDSIKEDKAYMDKLANIAATFMTQ
FNDQHRAGAGIDKDKTSNLNFFGRNDKYYVWDKERQSLLAAKVTGTGSTTAGSPPVTTHT
TTLSTTPGDTEELQGLEIIKAMKVSAELVTQNGELKVAARGFGDNSDAKNSYVQNFSYSN
STVPPNITGTGTVVHTTSDMNGTADGSNAVLLTNIFNMEQKDTGLTIYKNPTAGSPTETR
PTGTVSLNNYYNSVTSALGIDSNAMDTKVKFQQDVMTQIEAWRTSVSGVNWNEELSNMIK
FQQGYSACARCMTTMDEMLDRLVNNTGLVGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]