dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|311105922|ref|YP_003978775.1| (Achromobacter xylosoxidans A8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis-specific methylesterase 1 [Achromobacter xylosoxidans A8]
Sequence length 352
Sequence
MKKISVLCVDDSALVRGLMTEIINSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLLEYT
EIIADKIRAASRAKLRAPAAHAAPAAPAPMLRRPLSSSEKLVIVGASTGGTEAIREVLQP
LPPDSPAILITQHMPAGFTRSFAQRLDALCAVTVREAVHGDRVLPGHVYLAPGGDMHMRL
GRSGANYVIELEASEPVNRHRPSVDVLFNSAAVAAGKNAIGVILTGMGKDGAAGMLAMHR
AGAHTIAQDEASCVVFGMPREAIALGAADEVVSLSAISERILTRLGDRGHRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]