dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374336984|ref|YP_005093671.1| (Oceanimonas sp. GK1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter [Oceanimonas sp. GK1]
Sequence length 594
Sequence
MPEPTAGYCSRWQRLLPFLGWWPLVNPASLRADAQSGLTNAIVVLPQGVAYALIAGLPPE
YGLYAAIVPAIIAALFGSSWHLISGPTAAMSVVVFTSVSPLAEPGTATFIALALTLTLMK
GVFQLVLAFARLGVLVNFVSQSVVIGFTAGAAVVIASSQLPTLLGITVDGNGSVTGTWWQ
LLHHLTEVDYYSLSVALFTVAACVGIKRWRPRWPNMLIALALASGLALLIDPDHEHIALV
GAIPAGLPPLSLPDFSLASISALAPGALAISLLGLVEAAAISRAIASRSHQRLDDNQEFI
GQGLSNLVGAFFSCYASSGSFTRTGINYTSGARTPMAAIFASGFLLLILLLIPGITTWLP
LPAMAGLLLVVAWNLIDVHHIGLIIRGSRSETTVLTATFAATLLVELEFAIYTGVILSLV
FYLKRTSTPRVVSILPDPDSKHPFFVNAERRRLPYCPQLRIVRIEGSLFFGAVNHVQEYL
QAIREPRLLIVGNGINFVDMVGADMLVQEAERRRELGGDLYLCNLREGVLRFLLRNNRLD
DIRRDHVFINKGQAIHRIYDQLDAEVCRTCTARIFRECHLRPPGQPAEKAKAEG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]