dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

1jdpA (PDB chains (SCOP 1.75))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (A:)
Sequence length 441
Sequence
erealppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvay
edsdcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaag
fqhkdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhev
fqeeglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgd
yaffnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssv
ekqglnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagq
vsidangdrygdfsviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr
ivehtnsspckscgleesavt

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]