dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|297622629|ref|YP_003704063.1| (Truepera radiovictrix DSM 17093)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Truepera radiovictrix DSM 17093]
Sequence length 236
Sequence
MSGPRGERLPFGAPGVTLRRTLPSARAWRHHLLLELPGRCAALSSAPLGGGFSRPRFVLS
CSVERGWCSDDPAGELRRYARALDLPPAETLGLLTAVSMAELETASAARAGWRVHALVTA
GVGNAAAAGGRDPLGAGAAGAGTVNLIVLLEGALEPAALVGAVQSATEAKTAALRDANVR
TPFGELATGTTTDTVSVVSLAPAPRSPYAGLATAPGFLVADTAYTALARALRRLDG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]