dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0112016 (Drosophila melanogaster 69_5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:BDGP5:2R:17973397:17976084:-1 gene:FBgn0034692 transcript:FBtr0113103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 465
Sequence
MPRKKPKVDTLEEIETNIKLLCDQSNNHMKVRAYEKALFGYNQILPSDCQGYYKDMSNVL
NTILAVDKEQELLQSFIRTGAAAEEESQDETNRRSKGRSHKPPIWERRESTDRGGRGAGR
DGKQGDDGGAGGGAGGDAAGGKRGNRIEAELRAARKKIEEQIAKKKKPKENFVDFYTDKD
RAAAVSAGAFDIKQSLQIKQKQDRNEALLIPDEADISSVIALGLKEIKNANPENAIHFFC
KALELNSTDINALISRSKCYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQF
EQSLMFFHRGLRARPELALFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSRKSGED
TPKSQAAGATGTSARTRQKPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVRADTHT
ESISAYAREAVEFLNKRQEFWRQQRPCTALPNHKNLPHDALPKWF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]