dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0070907 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:join(6491127..6491228,6491299..6491806,6491967..6492637,6492708..6492988,6493059..6493344); ID=FBpp0070907; name=Apc7-PA; parent=FBgn0029879,FBtr0070946; dbxref=GB_protein:AAF46175.2,GB_protein:AAF46175.1,FlyBase:FBpp0070907,FlyBase_Annotation_IDs:CG14444-PA,REFSEQ:NP_572329,GB_protein:AAF46175,FlyMine:FBpp0070907,modMine:FBpp0070907; MD5=085f90c31f7d4f346fa0cc3059599115; length=615; release=r5.30; species=Dmel;
Sequence length 615
Sequence
MASFLIVVEKMEIALFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLY
LLNANYKERNYRAALRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYR
QIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMA
LQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLH
DNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCE
QDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALIL
RGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQ
NSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAII
KLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSD
DESPVLDESDDIGMDNQQSINDLTTLCEATNAQGAEGAESVENSREASSSAAARSGQEED
VDEHDWIDVPDGMSY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]