dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0071288 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=X:complement(8972980..8973207,8973279..8974463,8974528..8974831,8974889..8974980); ID=FBpp0071288; name=CG7246-PA; parent=FBgn0030081,FBtr0071353; dbxref=FlyBase:FBpp0071288,FlyBase_Annotation_IDs:CG7246-PA,GB_protein:AAF46437.1,REFSEQ:NP_572520,GB_protein:AAF46437,FlyMine:FBpp0071288,modMine:FBpp0071288; MD5=072add571608018b6c1179dda1ed9449; length=602; release=r5.30; species=Dmel;
Sequence length 602
Sequence
MAEFIAEMQERLLPEYEQMKNYSVFTADQVREIVSRRERLFLKINKSHQSITDYLDFILY
EKHMHMTIVDKEKKMHVKLTGLKASIATRIMRLYREALAKFNHDRRLWSNWIKFSRKSNP
VEVAGIYEKMLLYHGDSPDLWVDAALWLYEFNRLNIDRVKDILLRGLQRHPDSEALNKCF
FDIMLKEAALASNERNLAENTLSEQDIKLERVEAVYRNSMANITQLDYFVKLLESCEDHQ
ELTGKLQRMIIDDMQEKFPREPGLWDLLAQRELRGFHLGDLEEEDLDTSDEEPASKKSRS
VNGRSLKRRIQLCVTVYKSAVEELQTTEMWNMYLDAMLALNSDGKTERILKQQCLADALQ
AGHRSQLMGVKHYATLRKMLCTAPSGREAAVTILTEALKNDSSVEMHELLLATHIQSDSE
PLIYELFNKIQKSMGSEALPLWRSVILYYRTRQDSLGARRLDEIYGLACKAAWPEFGELR
SDYLRYLWQERSVEEARKEYAKLAILPPMSLALHRQMVQLESSAAACDQASLKYWRMCYD
FMACYFGKTQPRVWVEYLAFERDHGEAKNISLLTQRALSTLEPQYVAAFEAERALAYVGA
SI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]