dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0077614 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2L:join(930335..930423,950492..950578,951587..952142,952256..953333,953396..953510,956249..956334,956404..956792,956860..956944,957052..957209,957279..957452); ID=FBpp0077614; name=CG4341-PA; parent=FBgn0028481,FBtr0077949; dbxref=FlyBase:FBpp0077614,FlyBase_Annotation_IDs:CG4341-PA,GB_protein:AAF51432.1,REFSEQ:NP_608558,GB_protein:AAF51432,FlyMine:FBpp0077614,modMine:FBpp0077614; MD5=e84627be094c934f2964861338d57e61; length=938; release=r5.30; species=Dmel;
Sequence length 938
Sequence
MPSLEPWLWGDSCSWLGMLAMLRLRLHKSNMDFTCLFCCSLAFVLYLNTLGAGFVYDDRR
AILANADVSGGTPWQRSFSNDFWGTPLTDSGSHGSWRPLCVLSFRLNYLIGGGFAPWGFH
LVNNLLHCVATALVVRVARTLLASVWAVLAAGALFAAHPIHTEAVAGVVGRADLAACVCY
LLTYLSYLRHMRWRESGDPRQWLALGATLILAAAGLLCKETAITALLVCALFDVMRGLSG
QVDKQRLRSVCIVLGALFCMAYCRLVIVPGPQTAFSSADNPIARTPSAWTRLLTFLYLPV
FNLRLLLQPNVLSFDWGMDALPRVTSLWDRRNAQSACFYSVLVGVAWGSCRQLLSGSKEV
THCGVSSTFPQYHIQKVASRKSRSKRKRLANNTKYQAFEAAYHQQQQEALPCRDCNNNNS
SGYVYEGSSPVAQAPAQAPHLVSSAFRGSRSSSSCSNSTNSSSSSSSSSSSSSSSSSSLS
GGFQCSSKDYALEGMSPANRHACVLIMSLSFLALPFLPASNLLFYVGFVVAERLLYLPSV
GFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAIN
PPKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQ
RAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQ
LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAAL
ELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHE
SAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAIL
HLLGRTNHAAASYKAALRLQPGDAITLGNLAKLGVTNV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]