dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0077930 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:complement(20800399..20801873,20801939..20802077); ID=FBpp0077930; name=CG3634-PA; parent=FBgn0037026,FBtr0078272; dbxref=FlyBase:FBpp0077930,FlyBase_Annotation_IDs:CG3634-PA,GB_protein:AAF51644.1,REFSEQ:NP_649260,GB_protein:AAF51644,FlyMine:FBpp0077930,modMine:FBpp0077930; MD5=0e469610be2cacbde018618330cd1587; length=537; release=r5.30; species=Dmel;
Sequence length 537
Sequence
MWDSSMFLSTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSINHISPWING
SDGQSESSNGSGSSSSSGSSSSSNGGAGGGGSGGAGASGSGSATTSTGTQMPECKVWRNP
LNLFRGAEYQRFFWATSKEPLTYYDMNLSAQDHQTFFTCEGDARKEEYEIMQTAWRERNP
MQRIKSAHSALEINAECAPAYILLAEEEAMTIMEAEKILKTALKVAEINYRKSQATQHQG
AIADGMHRRDTNVLIYIKRRLAMCARKLGKLKEAAKMFRDLTKEIPSIMSVLNIHENLIE
TLLEMQAYADCHAILAKYDDISLPKSATICYTAALLKARAVADKFSPDIASKRGLSQAEM
SAVEAIHRAVEFNPHVPKYLLETKRLILPPEHILKRGDSEALAYAFFHLKHWKQVEGALN
LLHCTWEGTFRMLPYPLERGHLFYPYPTCTECADRELLPAFHEVSVYPKKELPFFILFTA
GLCSITALLALATHQYPEPMGHLAQTVLTWISYPFQLLKERIEAFWPCNLLQQLSRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]