dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0082420 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3R:join(10441511..10441519,10441579..10441905,10442674..10442731,10442897..10442968,10443026..10443556,10443616..10443743); ID=FBpp0082420; name=CG14853-PA; parent=FBgn0038246,FBtr0082961; dbxref=FlyBase:FBpp0082420,FlyBase_Annotation_IDs:CG14853-PA,GB_protein:AAF55078.2,REFSEQ:NP_731925,GB_protein:AAF55078,FlyMine:FBpp0082420,modMine:FBpp0082420; MD5=df4aacb0b709e4555d1b4fd6b379ca31; length=374; release=r5.30; species=Dmel;
Sequence length 374
Sequence
MSNLLYMDKSNGNGVYAVRPNSSNGHMDNDNGLNGSGAPATTSTTTGTATAAGAALMATA
NNINIMNGAAAAAAASASGLPTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLK
DYKKALKYCKLILQYEPDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHA
SDVEADVDGDEAGDADEDGDADADGDGSESSNNCSEEEDNGWGDDEIDNVDVMDGEEESS
SSGDDFDLPIDDAGQDPAALAVHVHHSHTHSHSHSHNDSGSSRNSSSGGGGRSDNTTHSY
SSLLLEEEDDIVPVSLNFGLKENTAADLDVSNGNKVPSASCSDSESPTEPLTQRLAAILR
SKCGVSGGGSDETY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]