dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0086683 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=2R:10263524..10264111; ID=FBpp0086683; name=CG30075-PA; parent=FBgn0050075,FBtr0087555; dbxref=FlyBase:FBpp0086683,FlyBase_Annotation_IDs:CG30075-PA,GB_protein:AAM71006.1,REFSEQ:NP_725390,GB_protein:AAM71006,FlyMine:FBpp0086683,modMine:FBpp0086683; MD5=8446762e2113d9ad1d40b0582abe95e6; length=195; release=r5.30; species=Dmel;
Sequence length 195
Sequence
MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMR
RMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVM
KELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRI
TELEDTNQMLSQLSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]