dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0289329 (Drosophila melanogaster FlyBase 5.12)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=3L:join(18600605..18600762,18600818..18600969,18601104..18601254,18601310..18601506,18601561..18602090,18602237..18602387,18602447..18602520); ID=FBpp0289329; name=CG18231-PB; parent=FBgn0036796,FBtr0300052; dbxref=FlyBase:FBpp0289329,FlyBase_Annotation_IDs:CG18231-PB,REFSEQ:NP_649045,GB_protein:AAF49253,FlyMine:FBpp0289329,modMine:FBpp0289329; MD5=9d5ba74fbece2a55995a9b7946456b32; length=470; release=r5.30; species=Dmel;
Sequence length 470
Sequence
MGDNSGESEYVENNSVYSSITRLLKLLEMEEIFITNIKAYTNKLAEKVKNLQAYIDSVDY
EFQQSFEDREKYVGNPINAFSLVRRTHQDLPKWHNYSQQIVGMEELFALEEIIAKVPDKK
DMAYSLGEMHRIEQIYDLEAIELARGRIQGKQYDFRPSIRDCVALGEHKFKREDYQRASM
WFRVAIKHEPEGNAEIINSILGDPKVNLYTLYAKSMLIFGMIKSNPSMTIAEAKKISYEA
LNKASLADIKSLLNELLSQTDDEIVYEMNVNKTKPSDYEIGCRGQFLRRRNHVCTYNFTI
TEFLKLAPLKQEVLNWDPYIVIYHDVLNDDEIDKLKNHLNDTDAVEVNPIEKRIFQRINE
LTRLSFEHSDQQIVSKNGPRTHKHKKEYLKGTLLFFLNNVELGGAMVFPKLKISVFPQKG
SCLFWHNTLDPRSEPLECPVLQGNKRVITQKGAYNGRPMQYKKAKSNQKF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]