dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0184035 (Drosophila persimilis 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_18:1003328..1004080; ID=FBpp0184035; name=Dper\GL19928-PA; parent=FBgn0157525,FBtr0185543; dbxref=FlyBase:FBpp0184035,FlyBase_Annotation_IDs:GL19928-PA,GB_protein:EDW27842,REFSEQ:XP_002023665,FlyMine:FBpp0184035; MD5=565fb6f8e56668535657316fdda4245a; length=250; release=r1.3; species=Dper;
Sequence length 250
Sequence
MNSKAKLSLRIEKSRRPISEIAQELRRLKASPLRIDDEKELPKPSVSDRPVKRLDQLEPL
RLTRHRITQLLVRPAFEQAVTSCFVRVNVNGQGEQPEYRIAEIVGVEELGLGYFVDGIPT
NITLRLRYNSVAMLHELNDISNMAFSLPEFQLWYDCCVNQGISPPTNSLIARKKIELYNA
LQSEAKALAVIKQTCTLNMRPAHRGGILERHGATYPWRLQHPREATLSTPKPPSNQDEEL
NLESESDESA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]