dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

DDB0306518|DDB_G0268060 (Dictyostelium discoideum)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment |Protein|gene: DDB_G0268060 on chromosome: 1 position 1380972 to 1383578
Sequence length 814
Sequence
MGDHLKNTREWIRHSSNKDDGNNAEKTHFFGHHEEEDHEHMLFTKEELTNPKELAKAMKV
KIPLYVPIFNWIKSYSKEDLIGDILSSITVATMLVPQGLAYAVLAGLPAIYGLYSGWLPL
VIYSFMGGCKQLAVGPEALLSVLLGSILGGYTTPPEDMTLNDYLVSIALTLALLVGIVSF
LFGICQFGFLGGILSRWVLSGFINAVALIIAISQLDSLLGVRTGGGGHTSDTTHGSTSTS
ISGSTISSMSEVLTETSTHHPGPYEKFWTAITNLQDSDKTTVILSAGCVVFLVGMRFFKQ
FLVKKMGWKNAKYIPEILLTVILTCVITAVFGLDRECVNTSDHDENKCVEQGSGVSVLRY
VKGGFPTVGFPSFQANTIQELLPQAFLIVIVGFVEATAVSKGLATKHNYQINSNRELVAF
GVANILGSIFGSYPVFSSIPRTSIQDMAGSRTCLSGFITSCLLLITCLFLTRLFYYLPYC
AMASIIFVAAFGLIEVHEAMFLWKTRSWGDLIQFSIALLATFIFEVEVGILISVGMCIFL
VLKHSSSPHVYSVLGRVPGTNRFKDVAKFPEAEPIEGILLVRIDEVLYFANIGQFKQLLS
EIERMMDRSTNVTGSGSTPLQSIIINVVNIPVMDASALLTIEEMVTAYHKRNVKVAFVQM
SEKIKESFKQSGLYDIVTPQFIFDSNYEAVSFLEQSINYSNNNDSRQVNLNMPQSDQSYD
DLNNNEVGGFDQPSSSSSSRFNNQNFLNKNNDNNNNNNNNNNDNNINDDDYQNSYNNNNN
NGGGAILSDGLKLEDYSEPESDEFIQSSNQKSKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]