dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428779964|ref|YP_007171750.1| (Dactylococcopsis salina PCC 8305)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment response regulator with CheY-like receiver domain and winged-helix DNA-binding domain [Dactylococcopsis salina PCC 8305]
Sequence length 244
Sequence
MENHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEAITTFNENNPDLVVLDVMMP
KLDGYGVCQELRKESDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVL
RRVDKEGLSGIPSSGVIQIGSIRIDTNRRQVYKGDERIRLTGMEFSLLELMVGRSGEAFS
RSGILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYMFQRVTEIG
EEKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]