dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428780509|ref|YP_007172295.1| (Dactylococcopsis salina PCC 8305)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment signal transduction histidine kinase [Dactylococcopsis salina PCC 8305]
Sequence length 374
Sequence
MNHSLDTAKTKPDTILVVDDSPDNVLLVQSILEEDGYHIEVAEDGEGAIAQVEANPPQLI
LLDVMMPGMDGFEVTERIRQQKALPFIPILLITAYDQPSVVKGLDSGADDFIRKPVELEE
LLARVRSLLRLKHSVDERDEIARQRSDFVSRLTHDLRTPLVAADRMLSLFQQGALGELSP
PMAEAVATMSRSNRNLLDMVNTLLEVYRFEAGRKVLNFVTVDLKAVIDEVVQELNPLAEE
KGLDLKKQEEIEGNQTETKVEGDRLELRRVFTNLIGNAIKFTDEGSVKVSLKQVTETEPP
TLLITVEDTGPGVSPEDQNRLFERFRKGKHRNSGSGLGLHLSQRILESHNGSISLESEVG
KGSRFTVKLPVKVE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]