dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|350268880|ref|YP_004880188.1| (Oscillibacter valericigenes Sjm18-20)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment putative YjgF/YER057c/UK114 family protein [Oscillibacter valericigenes Sjm18-20]
Sequence length 126
Sequence
MLHITNTENAPSAIGPYSQAISANGFLFASGQVALVPGTGEVAGTNIEGQAERCCQNVKG
ILEANGLTFDDVVKTTCFLADMNDFAAFNAVYGKYFTSKPARSCVAVKTIPKNLLCEIEV
TAVVNQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]