dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GRMZM2G109879_T02|PACid:20848461 (Zea mays v181)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 586
Sequence
MPLPSDSGSGARAMSKQFKVLLPTSFHKLRISDELAGCFDAGEGEGAPEPTALVVSPFGK
VWRVEVVRDGHGASLGRGWAEFLAAHGVGIGWFVVLRYEGGGALTVKVFDTSLCIKEFGA
PAAVMPSKSCKSIFCKPQFIRIFHSNLSEKMMLPARFVKDYVSEECLNSRIAIIFSPIAK
FWRVELKNDQSGIFFTGGWSQFLDFHGIKNGEVLLLKYEGNMVFKFKAFGLSGCQKDFKN
QNAGIQLNTKKQQETPPIRKRKSNDEKSSSEENKRLKTPVTSPSPSDPSLEKPYQIGTSS
WIKKRINTYALEQFLALSVKFCNSIGFRMACTITLKTATNSTRSWQVRGTAYKWHRYIIG
VGWKSFCQDNRLKAGDLCTFNIIETTLWHVTITRSALAADTFNKQKKPPCSSSRDKKGSS
SREGAKRPKPSMAHFSKVQVPPSYARRCAYDVGPPPWIRKQMNASTIRNRLVRMVILAFD
SRKLVIGVKIIQNTYEPVWHRPSAIRLSCGDAARSCSRPRSTAIILGGLVVSRRRRVVTL
LGPVGKNSARRTELRLVMSAPSMSSKPSCGMSSSHAVAKLWLLQPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]