dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSEEUP00000002264 (Erinaceus europaeus 69)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2395:2771:139592:-1 gene:ENSEEUG00000002471 transcript:ENSEEUT00000002478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 514
Sequence
MILAWRYLWRALNLEKPSPRILKTCLSWNLAASWTTVTKLSLHTKPKMPPCDFTPERYQX
XXXXXXXXXXXXXXXXXXXXXXXXPLLLHQGHMEWLFDYEGNRYLDFFSGIVTVSVGHCH
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIFLTNSGSEANDLAMLM
ARAHSNNTDIISFRGAYHGCSPYTLGLTNVGPFKMELPGGSGCQAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXCCQAKDQYIEQFKDTLNTTVAKSIAGFFVEPIQGVNGAVQYPK
GFLKEVFKLVRDRGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VVTTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIKEEKLQENSQEVGTYMLLKFAK
LRDEFEIIGDVRGKGLMMGIEMVSDKTSRQPLPREEVNQIHEDCKQMGLLIGRGGIFSQT
FRIAPSMCITKSEVDFAVEVFRSAIIQHMKRRDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]