dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|379718101|ref|YP_005310232.1| (Paenibacillus mucilaginosus 3016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PM3016_96 [Paenibacillus mucilaginosus 3016]
Sequence length 166
Sequence
MSFEALLDTMTELNEIHNSLLELAEQKRHVLIHNQVEQLMQIVTKENKMLKRIGELEQQR
VEVTGAFLMEKGYKPNPRVTVSDLTKILFNIEDKKLLLDKQKQLAAAIRKLRELNRVNQQ
MIEHSLAYIDYSLDLIVGPPEDEFVYKNPQAGASGPKRQGMFDSRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]