dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|334341732|ref|YP_004546712.1| (Desulfotomaculum ruminis DSM 2154)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment response regulator receiver [Desulfotomaculum ruminis DSM 2154]
Sequence length 252
Sequence
MLTVFIAEDDSSMRHVLKRTLEQIPGTKVLGEAGDGVTALKMIEKLRPRVVFIDIDLPEK
NGVDLAREICDIDPQILLIFATAYDDYTHEAFEVYAFDYLVKPFKLDRVKKTLERINQMD
LQRASAANYFHPPVAGEITPPRLVLRQNEKLLFLDTQEVILITRENRKTILHTTKQKLET
TETLNDIERRLTGNSFFRSHRGYIVNLSLIKEIYPWGKKGYQITFSGTKETALLTNEKFK
ELEKRLLYPETN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]