dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386720659|ref|YP_006186984.1| (Paenibacillus mucilaginosus K02)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein B2K_00480 [Paenibacillus mucilaginosus K02]
Sequence length 166
Sequence
MSFEALLDTMTELNEIHNSLLELAEQKRHVLIHNQVEQLMQIVTKENKMLKRIGELEQQR
VEVTGAFLMEKGYKPNPRVTVSDLTKILFNIEDKKLLLDKQKQLAAAIRKLRELNRVNQQ
MIEHSLAYIDYSLDLIVGPPEDEFVYKNPQAGASGPKRQGMFDSRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]