dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|32476575|ref|NP_869569.1| (Rhodopirellula baltica SH 1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein kinase related protein- PQQ-dependent oxidoreductase [Rhodopirellula baltica SH 1]
Sequence length 1129
Sequence
MVGGFTFINMLANELIDQLERRGLLDQEIIEALREQMSQGGSRVTPEAVAKLLVDNGQLT
RFQATKLIGELRSESYDSEAAEVIEGEEDLTAQLIDDEEVAEAVIEDDDPFGDNPVEVEA
IEAEPVEVVAEAEVMGDAMDGAPSRGRPSARVKKPETKSTWDSFKIYGYLGIIGFLIIAG
GVLWFVLSKGNADEFIALANKQYDSQSYQPAQDAYIAYLDQFGENSQYSSLARTRITMCE
LFRAEQMTDPVAGLEMAKEKLPTIINEEAMNDERGNLAGFLVDVAENIAREAEAAKETEE
KRRLLERLDEQQTLIDNPNYMLSTMKTTLSGRLLQLSEARNRVKREIDRNVRLDATEAAM
QSALAEKKTKEAYDERDSLLRDFPELAKDPRLVTLIEEASDIQQTLVKPSAKTPKITNEP
ASDAAVKSIVLTTRQGDSIPGVEEEVFFLRAGGSVLAFAVDDGRLLWRDYTGQGEDYTPL
RLDDGTAVLLSDMANDEIRRCRGEDGEVEWRAKFGEPFVEPVSGRDSILVTMDSGTLVSL
DSDSGDVKWSTDLSQELSTPAGLDDTLNRIYIPGSHSNLYVLNARDGKCIESLYLEHDEG
TIAVAPVSLLGHVFVIENAGSDYAQVHVLKVDENGENIKIAQSPFRLDGNVVVPPIVQNR
RLIVLTDRGQVAVYDIEPTSEKEQVSLIAQQVAAYDKPTLTRMAVGRSQMWITGTRIGRY
ELQINTGRVVYDWGKNEGDTFIGQPLSLEDVLVHARVLKGTSAIRVTAAEPKTGRELWRT
DVGTPIAMITRAPESGFHAVTSQGALFELTAESLSEGSTQGPIENPGANGISMSFQNPIV
VDDVRRMLLNQSQKGEALIYDPTRRSEKLRKVTFQLTGPKPTGVATFSGGGLFLPLDTGR
AVLMDWQTGSVKGAPFQPASDPTATVQWTNPIKSAADPDQVLIADSRKKLYRLRVGDQIR
ELSSVDLESPFLGTVAGIESSLLGSVSGPASDYLVGHDQTGLEQTFKKVLDGRIVWGPIA
APSDSNGEIALLITDDQVLRGFSASGEPLFQTQMPEGGLLVDQVVSTGGRWVLTGKDGWL
TAVDPASGNVVGTTLLGQPLSAGPLPVGDKLLVPGTEGVVYITNIPGDA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]