dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|337745858|ref|YP_004640020.1| (Paenibacillus mucilaginosus KNP414)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein KNP414_01586 [Paenibacillus mucilaginosus KNP414]
Sequence length 531
Sequence
MVPLTPPFHALNPPLFFLYNRGYWTSAPTFLRVESHIQLFYDQGGFLLLAPQLKNHWFSN
TRADLLSGITVALALIPEAIAFSIIAGVDPMVGLYASFSIAVLVSIFGGRPAMISAATGA
MALLMVNLVKDHGMEYLFAATVLAGILQWFMGVLKLGRFITFVPHSVMTGFVNALAILIF
MAQLVHFTGQGWLMYALVGLTLVIIYGLPRITKAIPSALAAIIIVSVLVISLGLDVRTVG
DMGEITNAPPVFHLPQVPLTMEMLAIIFPYSLSLAVVGILESLLTATLLDDMTGTRSDKN
REVRGQGIANIATGFFGGMAGCAMIGQSVINVKSGGRTRLSTFVAGAFLLFLIMVLGSVV
KQIPMAALVGVMFMVSFGTFDWSSLRNIRTIPYSDSLVMLVTVVIVVATHDLSKGVFAGV
ILSAVIFAWRMARIRTTSHTDAKGVKIYTVHGQLFFGTVSGFLEGFDAENDPRQVVIDFS
HSHLWDHSAVNALAKVKAKYESAGKSVKLAGLNEESQGLLKRTGLGTSSAH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]