dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|568182246|ref|YP_008954862.1| (Pseudomonas monteilii SB3078)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment enoyl-CoA hydratase [Pseudomonas monteilii SB3078]
Sequence length 263
Sequence
MTFQHILFSIEDGVALLSLNRPEQLNSFNTAMHLEVREALKQVRQSSEARVLLLTAEGRG
FCAGQDLSDRNVAPGAEMPDLGESIDKFYNPLVRTLRDLPLPVVCAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLVPDSGGTWLLPRLVGMARAKALAMLGERLGAEQAQQWG
LIHRVVDDAALRDEALTLARQLATQPTYGLALIKRSLNASFDNGFDEQLELERDLQRLAG
RSEDYREGVSAFMNKRTPAFKGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]