dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|568184679|ref|YP_008957382.1| (Pseudomonas monteilii SB3078)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transglycosylase [Pseudomonas monteilii SB3078]
Sequence length 81
Sequence
MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLATYGGQALGIYQAGQAAG
FLGALVGAVILLLIYGFIKKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]