dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|312135000|ref|YP_004002338.1| (Caldicellulosiruptor owensensis OL)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribonuclease iii [Caldicellulosiruptor owensensis OL]
Sequence length 222
Sequence
MEEIEKALGYKFEDKNLLRLALTHKSATHSNKNCYERLEFLGDAALELAVSKYLYVYFPE
LSEGELTNIRAAVVCSQTLSKVAEKLNLKNHIIFGKREKMEKFYENKSILADVLEALFGA
IFIESGFDTVEKIIVNLLKPYIQKAVAGKLFYDYKTKLQEIVQREGQKKIVYKDCEILEK
KYFKSELFIEGKKVSEGYGTSKKEAQQDAAYKFLLEMGEQEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]