dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|312797035|ref|YP_004029957.1| (Burkholderia rhizoxinica HKI 454)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RpiR family transcriptional regulator [Burkholderia rhizoxinica HKI 454]
Sequence length 854
Sequence
MTRARSKTRCRRRSATRCSRRWPRISARAVPRSRCRAAPARDRFCRLCRDARSTGRASTL
PWSTIAGSRRCMPTAMRDSCATRCCSTRRARPCSGRWSTSIKRPLPTSRHSTRMLRARCP
TWPCSAWEKMATRRRSSPTRRSGSWPHKPASAMCWSSRGRRRICGSACRCRRSGKSAGCF
CWSPGSASWMCCALRSSIHSTTPSPSWPTIRESTSMPTGAPKAVLARQSPHSDGPRLLAD
IGGTNARFALEFGPGQIDGIRVYSCADYPGIAAAIRKFLKDSGVGRVNHAAIAIANPVDG
DQVQMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPSLSDAQRAQIGGGVRRQNSV
IGLLGPGTGLGVSGLIPANERWIALGSEGGHATFSPQDEREDRVLHYARKKWPHVSFERV
CAGPGLALIYRALAERDNKRLDTPLEPADVVRRAQAAEPLALEAVECFCAVLGTFAGNIA
VTLGALGGVYIGGGVIPHLGELFSTSPFRARFEAKGRFQAYLANIPTFVITAQYPALLGV
SAILAEQLGHHAGGGSAAFERIRQMRDVLTPAERRVADLALNHPRSIINDPIIDIARKAE
VSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTNPVSHSQVHLGDSATDFGAKVLDNTVSA
ILQLREQMNFDNVERAIDMLNSARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYGDLYM
QAASAALLGKGDVIVAVSKSGKAPELLRTLEVAMQAGAQVIAITSSNTPLAKRASVALET
DPIEIRDAQLSMISRVLHLLVIDILAVGVAIRRALPDAGMQQVVEAVRGHADEDCAAVLD
WLSHGAALERRDTQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]