dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|330816144|ref|YP_004359849.1| (Burkholderia gladioli BSR3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pyridoxamine 5'-phosphate oxidase-related FMN-binding protein [Burkholderia gladioli BSR3]
Sequence length 690
Sequence
MKLTQTETASPWHEGELAIQRRTGVAGKMHEVGRRVVRDYMPDQHREFYAQLPFIAFGAV
DERGDAWASFLSGHPGFMQSPEPGRLHVEAGVDPADPAAPGLYEGAAIGLLGIELHTRRR
NRMNGTLRAHTAGGFDVQVRQSFGNCPQYIQLRDFGFVREPSQYTDIAPLEFDHLDARAR
GIIAAADTFFVASYVGEGEARQVDVSHRGGNAGFVRIDEDGRLTVPDFAGNLFFATLGNF
LVNPRAGLVFVDFETGDMLQMTGEASVELESEEIAAFQGAERLWHFKPRRVIHRRQAMPL
RWRFRADGWSPNSLMTGSWDEAASRLKAAALAHAWRPFEVTRIVDETPAIRSFHLQPADG
AGLLPHAAGQHLPIRVTPPGQERALIRTYTLSTAPSDGVYRISVKRDGLVSAYLHDTLRL
GSTLETRAPAGAFTIDAAQTRPAVLLAAGVGVTPMLAMLRHIVYEGLRKRRVRPTWFFHS
ARSLGERAFSAEIAQLAAASKGAVTVVRALSDTVGAQAHEDYDFGGRLDIALLRRTLPFD
DYDFYLCGPGGFMQSMYDALRDLNVADARIHAEAFGPSGLQRRRDAATAAAPAREPATEP
TPVAFVKSGKEARWQPDGGSLLELAEARGLAPEYGCRSGSCGSCRARVVEGAVAYPRAPE
FEVAEGEALICCAVPASPASGGGSRLLLDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]