dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|330821948|ref|YP_004350810.1| (Burkholderia gladioli BSR3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein bgla_2g28830 [Burkholderia gladioli BSR3]
Sequence length 730
Sequence
MRLKLLCTASATLVAVSLLAGGIARADEGMWQPSQLPSLAPQLKHRGLALDPRQLASLKS
WPLDAVVGLGFCTASFVSPDGLIVTNHHCGYGALQYNSTPEKNLIENGFLARAKADELPT
APTQRVYVTEQVTDVTDRIEAAVPPGSDGYARYVAIDREKDRLVRECTTPGYHCQVQTFS
GGYDYQLVRQKELRDVRLVYAPPESIGKYGGDIDNWMWPRHTGDFSFLRAYVARDGSSAT
YAKDNVPYRPKHWLSVNPQGVKAGDFVMVAGYPGRTNRHLLPDELRSAIDWQYPTLIRAL
GDMNRIIDTAGKQRPAVAVAYADQVAGFNNSIKFYQGNRDELANGEALSTRREQEAALHR
WLAAQPAGGKLDAPARLADVERLNRLVDARMATRERDLILHLLQQTQLYRASYRIVRLAD
EKQKPDAEREDGFRQRDEIDLLGQQKSIDRRYDPAVDRQLLVYVLQRYVRLPADQHIGAL
DRWLGGANDASALVAKVDALYAGSRLTDQATRVALMSATPAELAASHDSWIALTRALMPD
LLAIEHVDKAQDGDEAAARAGYMKALTAYSEARGLPVYHDANLSLRVSFGTVQGYRPRDA
VEYLPFTTTDGIVQKNTGVAPFNAPAAELAAIRAHAFDGFAGPGADALPVNFLADLDIAG
GNSGSPTLDRDGKLVGLVFDGAWEGISAGWLFDPAVTRSIHVDVRYMLWVMHHLDHADNL
LREMNVAVPD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]