dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|507716698|ref|YP_008049307.1| (Paenibacillus polymyxa M1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment High affinity sulfate transporter 2 [Paenibacillus polymyxa M1]
Sequence length 593
Sequence
MKWRGRFEGYNAGALRKDLISGSIVAIVAIPLGMAFAIASGVKPEYGLYTTIIAGILISL
LGGSKFQIGGPTGAFIPILLAIVMQYGYENLLIAGFMAGIMLILMGVLRLGALIKFIPKP
VTIGFTAGIAVTIFSGQIANFLGLRGVERHETFLPSMAEIIHRLPSLNVYSILTACICLA
GLIVVPKKWPKIPGSLVGLLLSTLVAALFFPGQVATIGSAYGAIPASLPELHIPAMTWEL
IVKLLPPALVIAMLGAIESLLSAVVADGMTGDRHNSNRELVGQGIANLLTPLFGGIPATG
AIARTATNIRNNAVSPMSGIVHGVVVLLILMLFAPYASNIPLASMAPVLMVVAWNMSERK
HFAHILKTRTADSIVLVVTFLLTVFTTLTTAVEVGLILAVVLFVKRMSNTLSVDKVLPDP
SVKHEKVGAHMVTEQHDCPQVAIYNVEGPLFFGAASALENSGVGGQTGLQQGILLLRMGK
VPFMDMTGEANFTALIQKYRKSGGTVLVSGLQPQPLELLHKTGCYDMIGQNHFFEHTGEA
LTAALAMVNQDRCSGCRQMAFRECTSLCRRTQETKSSFPEGAVSVPIPVNSGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]