dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|325299350|ref|YP_004259267.1| (Bacteroides salanitronis DSM 18170)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA mismatch repair protein mutS [Bacteroides salanitronis DSM 18170]
Sequence length 873
Sequence
MAKDNDVVLTPMMKQYFDLKAKHPDALMLFRCGDFYETYSEDAVTASQILGITLTRRANG
QAKTVEMAGFPHHALDTYLPKLIRAGRRVAICDQLEDPKTTKKLVKRGITELVTPGVAIS
DNVLSYKENNFLAAIHFGKTACGIAFLDISTGEFLTAEGPFDYIDKLLNNFAPKEVLFER
GKKPMFEGNFGSKFFTFELDDWVFTEASAREKLLKHFETKNLKGFGVEHLKNGIIAAGAI
LQYLDMTQHYQIGHITSLARIEEERYVRLDKFTVHSLELISSMNEGGTSLLDVIDHTISP
MGARLLKRWMVFPLKEVKPINARLDVVEYFFREPDFKDFIEEKLHRIGDLERIVSKAAVG
RISPREVVQLKVALQAIEPIKNACLNADNESLRRIGEQLNLCVSIRDKIAKEIVNDPPLL
VNKGGVIADGVNAELDELRRISYSGKDYLLQIQQREIEQTGIPSLKIAYNNVFGYYIEVR
NAHKEKVPAEWIRKQTLVNAERYITQELKEYEEKILGAEDKILVLETKLYNDLVADLAEF
IPAIQINATQIARLDCLLSFADVARENKYIRPVVADDDVLDIKQGRHPVIEKQLPVGEKY
IANDVYLDTESQQIIIITGPNMAGKSALLRQTALITLLAQIGCFVPAESAHIGLVDKIFT
RVGASDNISVGESTFMVEMNEAANILNNLSPRSLVLFDELGRGTSTYDGISIAWAIVEHI
HENKKAHARTLFATHYHELNDMEALFPRIKNYNVTVKEVNNKVIFLRKLERGGSEHSFGI
HVAKMAGMPQSIVKRADEILHRLEQENRQEGMVSRPKVQASAPKDGVQLSFFQLDDPVLC
QIRDEILHLDVNNLTPIEALNKLNDIKRIVTGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]