dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374320748|ref|YP_005073877.1| (Paenibacillus terrae HPL-003)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment arginine biosynthesis bifunctional protein argJ [Paenibacillus terrae HPL-003]
Sequence length 408
Sequence
MSKSGFTVVNGGNIVTPRGFTAGGLHCGLKNTDRNDIGVIRCEVEATAAAVYTTNVFQAA
PLKVTRESLVDGRLQAVVVNSGNANACTGQQGEQDAYAMRSAAARELGIAESNVAVASTG
VIGEHLKMDRVLGGISALPGRVNGESDGAEQFTQAILTTDLVKKEACVAVEVDGVTIHIA
GAAKGSGMIHPNMATMLAFMTCDAAIGQTALHQLLKQATDTSFNMITVDGDTSTNDMLIA
MASGLAGNRELQAEHPDWAAFAEAFTYICRELAKAIARDGEGATKLVEVSVSGAVSDASA
QAIAKTVIGSSLVKSAVFGADANWGRIIAAVGRAGEPVNPDTVDIRLGDIVVLSASSPVA
FDEDEALSYLRGDTVRIIVDLHHGNGTATAWGCDLTYDYVRINAAYRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]