dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|188535146|ref|YP_001908943.1| (Erwinia tasmaniensis Et1/99)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment decarboxylase [Erwinia tasmaniensis Et1/99]
Sequence length 517
Sequence
MVLGSHTSQVTERHPGYRAGDPHDFIFNDHQLPAWVQQSEQVLALITETVKGVEKPFSGI
LPHELAREFSGVNLDQPLGSNEAALEELKKLYLRDAVWFHHPKYVAHLNCPVVLPSLLAE
QIMATVNSSVDTWDQSAGGTLIEQKVIDWTLGRIGLPAGADGIFTSGGTQSNLMAMLLAR
DSWCAAHHQGHMIKHQGLPQDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVIPVDFDEHY
RMDAACLEQEIQRCHQQGLIPIAVVATSGTTDFGSIDPLGAISDLCNQHGMWMHVDAAYG
CGLLVSENHRQRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHNLSHVTHHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRISGPTALGNAFDDILALTQTTHQLLNAHP
TIEVLHAPELTTQIFRYVPRPGLNDEQIDDINANIRKAVFRSGNAVIAGTKVNGRQYLKF
TLLNPNTTVADIEDVIALIVHYGREQACGPTVTTAHL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]