dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|73667000|ref|YP_303016.1| (Ehrlichia canis str. Jake)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ehrlichia canis str. Jake]
Sequence length 1049
Sequence
MGDIGMISALQAPNEIRKRMQMLYRTEENSYARYLTEKTEVSQDSKIRIYSVAKQIIEKI
RVDRNLGIIDAFMQEYGLSNEEGIALMCLAESLLRIPDDCTINDLIKDKIGNSMWSNHIG
SSSSMFVNAATWGLFIGGIVLKESNDSAKWFGTINNLLKTMGEPIIRKAIQQAMCTLGKH
FIKGRDITEALNNRKEGELYSFDILGEAAKTRKDAERYFSEYMQAVDSIGKSKGSDDTGR
LVDYDEISVKISALHSRYEFSQIDDVLDEIVDKLLQICRLAKEYNIRVCIDAEEASRLEI
SLMILEKLRFESSLNGWEGLGLAVQAYQKRAFSVLDFVEDISVRSCHKMMVRLVKGAYWD
YEIKNSQELGLSSYPVFTRKVYTDVSYLACANKILSKPNTFYPCFATHNAYTLAAILEMA
NKDHPGFEFQRLHGMGASLYEYVTQELAANIKCRVYAPVGGYQDLLPYLIRRLLENGANS
SFINQLNDSNISLEQLIQDPLEKAKELEYLPHPNIPLPKDIFGPERLNSSGIDITDSVTL
ANFNDEMKNYQNCKFKASSIVNGEEFDGDFIEILSPSNSEDLVGEVLFASSTQALSALDI
AYSAFKDWSNVPVSTRASILEKAANLIEENKAKLIMLLIREGGKVISDAIAEIREAVDFL
RYYAVLGRQELEGSNRLPGPVGEDNYLYFRSRGVFVCISPWNFPLAIFIGPIAAALVTGN
TVIAKPAEQTSIIAYEAVKLLYDAGIPKGVLHLLLGDGKELGEVLLKNEKIGGVAFTGST
ETARIINQSIAEKEGGIIPFIAETGGLNTMITDTSALVEQVTNDVITSAFKSAGQRCSAL
RVLFVQEEVADKQIEMICGAMEDLVIGDPMLLKTDIGPVIDKASQEMLIAHADRMSQEGK
LLCQVKLGEECQKGYFFAPCAYEIQNISQLQREVFGPILHIIRYKKGDLHKILSEINDTG
YGLTFAVQSRVQSNIDNIIDNINVGNVYVNRNQVGAVVGVQPFGGQGLSGTGPKAGGPYY
LHRFLTEKVVSINTTALGGNTSLMCLTDQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]