dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MLOC_62500.2 (Hordeum vulgare 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:030312v2:7HL:5818804:5821326:-1 gene:MLOC_62500 transcript:MLOC_62500.2 description:"Uncharacterized protein "
Sequence length 268
Sequence
MSKTRPRFIKLLRPDDWEKMTIPDEFVQQHLIGAESCPSSQKALIIGPTGKLWPVELDQR
QSDVLYGEVWAEFLTAHDLSEGSILLFRYEVNMSFSVQVFLPNGCMKEYPYLADEADGSS
PLLPQSDKQLVAPSVSKRSYNKRQVVSGIPATFPAMKAQKVQSQSKPAGVVGRHSFTKQI
TSYSLKSLFAVKLTFCSSIGLLEACTIQLKTSMGGSARSWPVAFNIANTYGFLTGKGWKR
FCQDNEVEEGDRCTFKVVEKMVWHVVIN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]