dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|326315485|ref|YP_004233157.1| (Acidovorax avenae subsp. avenae ATCC 19860)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Acav_0667 [Acidovorax avenae subsp. avenae ATCC 19860]
Sequence length 249
Sequence
MRDNKKAAGYFADNISFSTKAMLKRFQDTEEFPRVEGRPGRAHDLVLYALQIVILRYSAG
DEIQAIKASVLQWIEARELQQRVLAPLPPKHEDKAMYERITLDTVYDALTMMAFGKALHF
NASEMKRLINAIGHPGEDALIDEGARALGDAQRPVAEACKFPKVYDPLLEVWRCDPSERP
AKLLAFSKVWKKKIKPIYWSDSLNGADGAYFGYWCFDVALAAIALDIPDEALRDNPYYPK
DLVDAARAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]